PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00018.1_g00047.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NAC
Protein Properties Length: 396aa    MW: 45918.6 Da    PI: 5.576
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00018.1_g00047.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM176.67.1e-5571361129
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvkaeek.ewyfFskrdkkyatgkrknratksgyW 83 
                              +ppGfrFhPtdeelv++yL+kkv+++++e+ ++ik++d+yk+ePwdL++  k+ +ee+ +wyfFs++dkky+tg+r+nratk g+W
  Rsa1.0_00018.1_g00047.1   7 VPPGFRFHPTDEELVDYYLRKKVASNRIEI-DFIKDIDLYKIEPWDLQElcKIGHEEQsDWYFFSHKDKKYPTGTRTNRATKVGFW 91 
                              69****************************.99**************9544444444359************************** PP

                      NAM  84 katgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                              katg+dk+++  +++l+g++ktLvfykgrap+g+k+dW+mheyrle
  Rsa1.0_00018.1_g00047.1  92 KATGRDKAIYL-RHSLIGMRKTLVFYKGRAPNGQKSDWIMHEYRLE 136
                              ***********.8899****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.57E-595156IPR003441NAC domain
PROSITE profilePS5100558.8287156IPR003441NAC domain
PfamPF023651.1E-288135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 396 aa     Download sequence    Send to blast
MNSFSHVPPG FRFHPTDEEL VDYYLRKKVA SNRIEIDFIK DIDLYKIEPW DLQELCKIGH  60
EEQSDWYFFS HKDKKYPTGT RTNRATKVGF WKATGRDKAI YLRHSLIGMR KTLVFYKGRA  120
PNGQKSDWIM HEYRLETDEN GTPQEEGWVV CRVFKKRLAA VRRMGDYDSS PSHWYGDQLS  180
FMASELETNG LRRILPNHQQ QQHQQEHQQQ LSYGFNSSVY ALNSPNLQCK QELELQYNHL  240
VQQHDLFHES PLSLFQLPQL ESPNVQQANN NNSLPYGTSN NDNNSSEIAN LQQPNLAHEE  300
QLNQGNQNFS TLYMNSENEQ GVDQVTDWRV LDKFVASQLS NEDAAATTSA SLQKNAKDTS  360
NVEYQVDEEK DQKRVSDMGE EYAASTSSSC QIDLWK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-50615714169Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0297610.0BT029761.1 Arabidopsis thaliana At1g12260 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013671757.10.0PREDICTED: NAC domain-containing protein 7-like isoform X1
SwissprotQ9FWX20.0NAC7_ARATH; NAC domain-containing protein 7
TrEMBLM4DTA70.0M4DTA7_BRARP; Uncharacterized protein
STRINGBra019750.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM21112678
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G12260.10.0NAC 007